Structure prediction with Boltz

Boltz, is an open-source and fully commercially available model from the MIT Jameel Clinic, designed to accurately model complex biomolecular interactions. It can be used to predict structure from a single protein sequence, or more complex problems involving multimer proteins and ligands.

Useful links

Usage with Ginkgo's AI Python client

First, initialize the Ginkgo AI python client. You will need to first get a GINKGOAI_API_KEY. To get your API key, go to models.ginkgobioworks.aiarrow-up-right and create a free account. Copy your API key, which should be visible once you have logged in.

First, install the Ginkgo ai python client ginkgo-ai-client:arrow-up-right

pip install ginkgo-ai-client
from ginkgo_ai_client import GinkgoAIClient, PromoterActivityQuery

# If the api_key field is omitted, it will be read from the env GINKGOAI_API_KEY
client = GinkgoAIClient(api_key="xxxxx-xxxx-xx-xxxxx-xxx")

Structure prediction with a single protein sequence

Let's ask Ginkgo's Boltz server for the structure of the GFP protein!

sequence = (
    "MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL"
    "VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV"
    "NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD"
    "HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK"
)

query = BoltzStructurePredictionQuery.from_protein_sequence(sequence)
response = client.send_request(query)

The response contains a link to a structure file which can be downloaded either as CIF or PDB:

The response also contains confidence data. Here a confidence score of 0.95, close to the maximum of 1, indicates a high confidence in the result.

Predictions with multimers and ligands

For more complex problems with multiple protein chains and ligands, the best is to start from a YAML Boltz input file (see the Boltz instructionsarrow-up-right, and examplesarrow-up-right for more details).

In this example (in full herearrow-up-right), we start from a typical Boltz YAML input file defining a dimer (a protein with two chains A and B sharing an identical sequence), and ligands.

We load the file with from_yaml_file and submit it to our Boltz server:

And voilà:

A dimer with two identical chains (left and right) and identical ligands docked in each chain

Handling larger batches

For large sets of queries, it is better to use an iterator, managed via send_requests_by_batches .

Processing a FASTA file with many protein sequences

If you have a FASTA file with many protein sequences, you might define an iterator that builds a query for each protein sequence in the file

Then the queries are generated and sent in batches via send_requests_by_batches and the results are processed as they become available:

Processing a folder with multiple files

If your input is more complex, with multiple chains and ligands, and you have a folder with different YAML Boltz input files, here is how you would use send_requests_by_batches 👍

Throughput and Pricing

The Boltz model can complete predictions on our servers in as little as 20s for short proteins and as much as ~4 minutes for more complex problems with multiple chains and ligands.

We only currently accept protein sequences under 1000 amino-acids.

The current pricing is a combination of:

  • A fixed cost of $0.01 per request

  • Plus an additional $0.00025 per amino-acid in the sequences (so $0.1 for a 400-AA sequence)

  • Plus an additional $0.0025 per ligand.

Last updated